(data stored in ACNUC7421 zone)

EMBL: CP002355.PE453

CP002355.PE453       Location/Qualifiers
FT   CDS             441479..442411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0454"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="COGs: COG0618 Exopolyphosphatase-related protein;
FT                   InterPro IPR001667: IPR003156; KEGG: abu:Abu_2037
FT                   exopolyphosphatase-related protein; PFAM: phosphoesterase
FT                   RecJ domain protein; phosphoesterase DHHA1; SPTR:
FT                   Exopolyphosphatase-related protein; PFAM: DHH family; DHHA1
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33121"
FT                   /db_xref="GOA:E4TZN3"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN3"
FT                   /protein_id="ADR33121.1"
FT                   /translation="MPLSLIDSADHIVLVAHKNPDADSLGAACAFYSYLLRSQKKITLF
FT                   CASSAVNPNLAFLPWFEKITDRFPDNADCIISFDCGSYGRLGIEKELPLINIDHHASND
FT                   FYGTHNLVNTHAISTTEVLYDYFVANGIKINGKMALSLYAGLLDDSKCFSASECSAKTF
FT                   SMAHALIELGADHAVCTEWLYRRGSLASLRVRGSLFKQMKLVLDGQLAVFEIPFVLLEE
FT                   TGASVAECKSAMDEALGMRSVKAALMVVHFPGKGIKLSLRTNGTVNAAAIMAEFGGGGH
FT                   VKRAGTYLKQENYDELIQTMMVKITKELV"
     MPLSLIDSAD HIVLVAHKNP DADSLGAACA FYSYLLRSQK KITLFCASSA VNPNLAFLPW        60
     FEKITDRFPD NADCIISFDC GSYGRLGIEK ELPLINIDHH ASNDFYGTHN LVNTHAISTT       120
     EVLYDYFVAN GIKINGKMAL SLYAGLLDDS KCFSASECSA KTFSMAHALI ELGADHAVCT       180
     EWLYRRGSLA SLRVRGSLFK QMKLVLDGQL AVFEIPFVLL EETGASVAEC KSAMDEALGM       240
     RSVKAALMVV HFPGKGIKLS LRTNGTVNAA AIMAEFGGGG HVKRAGTYLK QENYDELIQT       300
     MMVKITKELV                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page