(data stored in ACNUC7421 zone)

EMBL: CP002355.PE454

CP002355.PE454       Location/Qualifiers
FT   CDS             442408..443778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0455"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047; KEGG:
FT                   tdn:Suden_0671 peptidase M23B; PFAM: Peptidase M23; SPTR:
FT                   Peptidase M23B; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33122"
FT                   /db_xref="GOA:E4TZN4"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN4"
FT                   /protein_id="ADR33122.1"
FT                   /translation="MRRGRKNSGIVGWILVAAVLAALGFMAFSPVFERDDPKVTLSQEG
FT                   YWNFQDPIHVNVEDVSGLKSYKATISTPHDEWVVVDENNPSHEIKKSFDIRPPKGVRRV
FT                   DSNSIVLKIEATDNSLWGLFMGNTFKQEYTLVIDQRRPVLSIIANSYKIQKGGSAIVIF
FT                   KAEDANLESLKIQTNFGKTFIAQPFMKEGYYASLVAWPVQEASFSATVVARDKAGNEVR
FT                   NAIPLRLKDHVYRVSNIELSDQFLDGKIAELANTYEQTAGVDDRLEQFRIINEKVRADN
FT                   EKIIHGITSKVSKNMITDFNPVPFYPLVNGQKVADFGDHRIYSYKGQENVSQAYHMGLD
FT                   LASVAMGPITSSNGGKVVFSQPNGIYGNLPIIDHGFGLYTLYGHCSEVHVQEGDTAAIA
FT                   QEIAKTGLSGYAMGDHLHFGILVQGIEVRPEEWMDSKWIADNITSVIDNAKAIINQH"
     MRRGRKNSGI VGWILVAAVL AALGFMAFSP VFERDDPKVT LSQEGYWNFQ DPIHVNVEDV        60
     SGLKSYKATI STPHDEWVVV DENNPSHEIK KSFDIRPPKG VRRVDSNSIV LKIEATDNSL       120
     WGLFMGNTFK QEYTLVIDQR RPVLSIIANS YKIQKGGSAI VIFKAEDANL ESLKIQTNFG       180
     KTFIAQPFMK EGYYASLVAW PVQEASFSAT VVARDKAGNE VRNAIPLRLK DHVYRVSNIE       240
     LSDQFLDGKI AELANTYEQT AGVDDRLEQF RIINEKVRAD NEKIIHGITS KVSKNMITDF       300
     NPVPFYPLVN GQKVADFGDH RIYSYKGQEN VSQAYHMGLD LASVAMGPIT SSNGGKVVFS       360
     QPNGIYGNLP IIDHGFGLYT LYGHCSEVHV QEGDTAAIAQ EIAKTGLSGY AMGDHLHFGI       420
     LVQGIEVRPE EWMDSKWIAD NITSVIDNAK AIINQH                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page