(data stored in ACNUC7421 zone)

EMBL: CP002355.PE456

CP002355.PE456       Location/Qualifiers
FT   CDS             444705..445157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0673 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33124"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN6"
FT                   /protein_id="ADR33124.1"
FT                   /translation="MHDALVIALSSPILIGIYKDGVLVEEIREDGMSSDVLAEIFESLL
FT                   KRYTFRTFIYAKGPGSFMGIKVTYLFLKTLSITLKIPLLATDAFFFNQNSPIKAVGKLY
FT                   FVKNRTTIELEPIESPELIAFSLPENIDLKKFDSDTLPYYGIDAVG"
     MHDALVIALS SPILIGIYKD GVLVEEIRED GMSSDVLAEI FESLLKRYTF RTFIYAKGPG        60
     SFMGIKVTYL FLKTLSITLK IPLLATDAFF FNQNSPIKAV GKLYFVKNRT TIELEPIESP       120
     ELIAFSLPEN IDLKKFDSDT LPYYGIDAVG                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page