(data stored in ACNUC7421 zone)

EMBL: CP002355.PE457

CP002355.PE457       Location/Qualifiers
FT   CDS             445167..446048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0458"
FT                   /product="homoserine kinase"
FT                   /note="COGs: COG0083 Homoserine kinase; InterPro IPR000870:
FT                   IPR006204: IPR006203; KEGG: tdn:Suden_0674 homoserine
FT                   kinase; PFAM: GHMP kinase; SPTR: Homoserine kinase;
FT                   TIGRFAM: homoserine kinase; PFAM: GHMP kinases C terminal;
FT                   GHMP kinases N terminal domain; TIGRFAM: homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33125"
FT                   /db_xref="GOA:E4TZN7"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN7"
FT                   /protein_id="ADR33125.1"
FT                   /translation="MFVSVPATSANLGPGFDSLGLAVDLRNQVELVPSRFFAVSIKGEG
FT                   ENNPRLKGNNLFVSIFNEHYRRLTQKRQNFKFTFYNQIPMSRGLGSSSAVIVSAISCAH
FT                   EAAGVKVSKRRILNHALVYESHPDNITPAVMGGFNAAMVEKQKVFSQQKHLPDYLKAVV
FT                   VIPNKPISTAKSRTTLPKSYSKENAVFNLSHTAVTVGAFFNEDWEMLRLATQDRFHQKV
FT                   RMKMLPELFAVQKMAYDNGALMSTLSGSGSTFFNMVYDQDAKMLADKFKAEFSDFEIKI
FT                   LGFDNDGLVVER"
     MFVSVPATSA NLGPGFDSLG LAVDLRNQVE LVPSRFFAVS IKGEGENNPR LKGNNLFVSI        60
     FNEHYRRLTQ KRQNFKFTFY NQIPMSRGLG SSSAVIVSAI SCAHEAAGVK VSKRRILNHA       120
     LVYESHPDNI TPAVMGGFNA AMVEKQKVFS QQKHLPDYLK AVVVIPNKPI STAKSRTTLP       180
     KSYSKENAVF NLSHTAVTVG AFFNEDWEML RLATQDRFHQ KVRMKMLPEL FAVQKMAYDN       240
     GALMSTLSGS GSTFFNMVYD QDAKMLADKF KAEFSDFEIK ILGFDNDGLV VER              293
//

If you have problems or comments...

PBIL Back to PBIL home page