(data stored in ACNUC7421 zone)

EMBL: CP002355.PE458

CP002355.PE458       Location/Qualifiers
FT   CDS             446069..446323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0459"
FT                   /product="protein of unknown function DUF448"
FT                   /note="InterPro IPR007393; KEGG: tdn:Suden_0675
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF448; SPTR: Putative uncharacterized protein; manually
FT                   curated; PFAM: Protein of unknown function (DUF448)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33126"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN8"
FT                   /protein_id="ADR33126.1"
FT                   /translation="MAQKLHQPIRMCVVCRERFAQVGLLRLQCRNGKLEPYGKEGRSFY
FT                   MCRSCIEHKKTPGQLSRQCKSGATVELMNRLKEIIVNDG"
     MAQKLHQPIR MCVVCRERFA QVGLLRLQCR NGKLEPYGKE GRSFYMCRSC IEHKKTPGQL        60
     SRQCKSGATV ELMNRLKEII VNDG                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page