(data stored in ACNUC7421 zone)

EMBL: CP002355.PE459

CP002355.PE459       Location/Qualifiers
FT   CDS             446313..448850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0460"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /note="COGs: COG0532 Translation initiation factor 2 (IF-2;
FT                   GTPase); InterProIPR000178: IPR005225: IPR006847:
FT                   IPR000795: IPR 004161; KEGG: tdn:Suden_0676 translation
FT                   initiation factor IF-2; PFAM: protein synthesis factor
FT                   GTP-binding; translation initiation factor IF-2
FT                   domain-containing protein; elongation factor Tu domain 2
FT                   protein; SPTR: Translation initiation factor IF-2; TIGRFAM:
FT                   translation initiation factor IF-2; small GTP-binding
FT                   protein; PFAM: Elongation factor Tu domain 2;
FT                   Translation-initiation factor 2; Translation initiation
FT                   factor IF-2, N-terminal region; Elongation factor Tu GTP
FT                   binding domain; TIGRFAM: small GTP-binding protein domain;
FT                   translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33127"
FT                   /db_xref="GOA:E4TZN9"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN9"
FT                   /protein_id="ADR33127.1"
FT                   /translation="MMDKVRVHEIAKELGINSKEVVDKAAAMGLNVKTASSSVSIEEAE
FT                   QIMNYIMSGASTETAAPKPTSKAAPAEETPAVTVPPKTEHAPVAAAVSEVKDEPSEEAP
FT                   ADIEAPKRSGLKIVKKKRPQEEEFVAPVRQESIAVSSYGKLSEQAQRELEAKRAKKAQS
FT                   SNAPVQKKDQGVRLDIFGGGISDISMDYEEDQVVLMDFNDLGGKVEPEEEQKPKEKKPI
FT                   GRNAGKKQGANRNKPRQVSREARKKYTRDAKEDEVITHVEIPEDIRVYEFADKVRQPLS
FT                   EVIKILFNLGMMVTKNDFLGKDEIEILASEFGVEVTTIDPKDAFNYEDSYEEDNEDSAD
FT                   LEERPPVITIMGHVDHGKTSLLDAIRNAKVAHGEAGGITQHIGAYSVEQHGKLITFLDT
FT                   PGHEAFSSMRARGAQLTDIIVIVVAADDGVKPQTRESVKHAQEAKVPVIVAINKMDKPG
FT                   ANPDMVKAQMAELGLNPVDWGGDVEFVGVSAKAMTGIDELLEAILLQAEIMELKANPNN
FT                   MAKAVVVESTLEKGRGPVATVIVQNGTLKIGDNIVCGSAYGRVRALISDRKAQLQKIGP
FT                   SETAVVVGLSDVPPSGEILMVMESDKEAREFAQKRYEYDRHRELSHSTKTTLDELSSLI
FT                   AEGRLKALKVVLKTDVHGSLEAIRSALAELRNEEVKVEVISSGVGGITENDVALVNNSE
FT                   NCMLVGFNVRPTGNVNAMAKQMGIKINTYSIIYQLIDDVTAMLTGMMAPQFREENTGQA
FT                   EVRDTFPMPKGGGTIAGCVVVDGKLVRGGMVRVIREGVVIHEGDLTSLRRFKDDVKEVT
FT                   KGFDCGVVLNGYTDVKVGDVIETFTKIEKKVSL"
     MMDKVRVHEI AKELGINSKE VVDKAAAMGL NVKTASSSVS IEEAEQIMNY IMSGASTETA        60
     APKPTSKAAP AEETPAVTVP PKTEHAPVAA AVSEVKDEPS EEAPADIEAP KRSGLKIVKK       120
     KRPQEEEFVA PVRQESIAVS SYGKLSEQAQ RELEAKRAKK AQSSNAPVQK KDQGVRLDIF       180
     GGGISDISMD YEEDQVVLMD FNDLGGKVEP EEEQKPKEKK PIGRNAGKKQ GANRNKPRQV       240
     SREARKKYTR DAKEDEVITH VEIPEDIRVY EFADKVRQPL SEVIKILFNL GMMVTKNDFL       300
     GKDEIEILAS EFGVEVTTID PKDAFNYEDS YEEDNEDSAD LEERPPVITI MGHVDHGKTS       360
     LLDAIRNAKV AHGEAGGITQ HIGAYSVEQH GKLITFLDTP GHEAFSSMRA RGAQLTDIIV       420
     IVVAADDGVK PQTRESVKHA QEAKVPVIVA INKMDKPGAN PDMVKAQMAE LGLNPVDWGG       480
     DVEFVGVSAK AMTGIDELLE AILLQAEIME LKANPNNMAK AVVVESTLEK GRGPVATVIV       540
     QNGTLKIGDN IVCGSAYGRV RALISDRKAQ LQKIGPSETA VVVGLSDVPP SGEILMVMES       600
     DKEAREFAQK RYEYDRHREL SHSTKTTLDE LSSLIAEGRL KALKVVLKTD VHGSLEAIRS       660
     ALAELRNEEV KVEVISSGVG GITENDVALV NNSENCMLVG FNVRPTGNVN AMAKQMGIKI       720
     NTYSIIYQLI DDVTAMLTGM MAPQFREENT GQAEVRDTFP MPKGGGTIAG CVVVDGKLVR       780
     GGMVRVIREG VVIHEGDLTS LRRFKDDVKE VTKGFDCGVV LNGYTDVKVG DVIETFTKIE       840
     KKVSL                                                                   845
//

If you have problems or comments...

PBIL Back to PBIL home page