(data stored in ACNUC7421 zone)

EMBL: CP002355.PE46

CP002355.PE46        Location/Qualifiers
FT   CDS             complement(44375..45643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0046"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="COGs: COG0148 Enolase; InterPro IPR020809:
FT                   IPR000941: IPR020811: IPR020810; KEGG: tdn:Suden_2001
FT                   phosphopyruvate hydratase; PFAM: Enolase-like; PRIAM:
FT                   Phosphopyruvate hydratase; SPTR: Enolase; TIGRFAM: enolase;
FT                   PFAM: Enolase, N-terminal domain; Enolase, C-terminal TIM
FT                   barrel domain; TIGRFAM: phosphopyruvate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32714"
FT                   /db_xref="GOA:E4TW98"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW98"
FT                   /protein_id="ADR32714.1"
FT                   /translation="MIFIDEVSAIEVMDSRGNPTVKATVQLSDGTRESAVVPSGASTGK
FT                   REALELRDGDARYMGKGVLKAVENVNSQIADAIMGLSPFNQAMVDAAMKELDGTENYGN
FT                   LGANAVLGVSMAVARAAAKSLGIPLYRYLGGANAMVLPVPMLNIINGGSHADNSVDFQE
FT                   YMIMPIGFDDFSEGLRASSEVYHNLKTILKNRGANTALGDEGGFAPDLSSNEEPIQVIM
FT                   EAIAKAGYKAGEQIAIALDVAASELVTEGGYRLDSENRTVTSAQLVDYYVDLCSKYPIV
FT                   SIEDGLSEDDWDGWKLLTEKLGNKVQLVGDDLFVTNASILAEGIEKGIANAILIKPNQI
FT                   GSVSETMLTVRLAQRNGYKCVMSHRSGESEDAFIADFAVALNCGEIKTGSTARGERTAK
FT                   YNRLLEIETEVMYGEYLGSSLFN"
     MIFIDEVSAI EVMDSRGNPT VKATVQLSDG TRESAVVPSG ASTGKREALE LRDGDARYMG        60
     KGVLKAVENV NSQIADAIMG LSPFNQAMVD AAMKELDGTE NYGNLGANAV LGVSMAVARA       120
     AAKSLGIPLY RYLGGANAMV LPVPMLNIIN GGSHADNSVD FQEYMIMPIG FDDFSEGLRA       180
     SSEVYHNLKT ILKNRGANTA LGDEGGFAPD LSSNEEPIQV IMEAIAKAGY KAGEQIAIAL       240
     DVAASELVTE GGYRLDSENR TVTSAQLVDY YVDLCSKYPI VSIEDGLSED DWDGWKLLTE       300
     KLGNKVQLVG DDLFVTNASI LAEGIEKGIA NAILIKPNQI GSVSETMLTV RLAQRNGYKC       360
     VMSHRSGESE DAFIADFAVA LNCGEIKTGS TARGERTAKY NRLLEIETEV MYGEYLGSSL       420
     FN                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page