(data stored in ACNUC7421 zone)

EMBL: CP002355.PE461

CP002355.PE461       Location/Qualifiers
FT   CDS             449202..449633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0462"
FT                   /product="protein of unknown function DUF150"
FT                   /note="InterPro IPR003728: IPR020790; KEGG: abu:Abu_2045
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF150; SPTR: Ribosome maturation factor rimP; PFAM:
FT                   Uncharacterised BCR, YhbC family COG0779"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33129"
FT                   /db_xref="GOA:E4TZP1"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZP1"
FT                   /protein_id="ADR33129.1"
FT                   /translation="MSLESDIKKMVESIGLSLYDTAVFNENENTIFRVSVTAPGGVSLD
FT                   QCVEATHLISPLLDVTPPVGGEYRLEVSSPGIERKLKTLDHFAQSVGEKVVFSTVNKEK
FT                   FDGEVVSVENEEITIKTKEGETHTVPFRSISKAKTYFEW"
     MSLESDIKKM VESIGLSLYD TAVFNENENT IFRVSVTAPG GVSLDQCVEA THLISPLLDV        60
     TPPVGGEYRL EVSSPGIERK LKTLDHFAQS VGEKVVFSTV NKEKFDGEVV SVENEEITIK       120
     TKEGETHTVP FRSISKAKTY FEW                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page