(data stored in ACNUC7421 zone)

EMBL: CP002355.PE462

CP002355.PE462       Location/Qualifiers
FT   CDS             449633..450643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0463"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /note="COGs: COG0117 Pyrimidine deaminase; InterPro
FT                   IPR004794: IPR002125: IPR002734; KEGG: tdn:Suden_0679
FT                   riboflavin biosynthesis protein RibD; PFAM: CMP/dCMP
FT                   deaminase zinc-binding; bifunctional deaminase-reductase
FT                   domain protein; PRIAM:
FT                   Diaminohydroxyphosphoribosylaminopyrimidine deaminase;
FT                   SPTR: Riboflavin biosynthesis protein RibD; TIGRFAM:
FT                   riboflavin biosynthesis protein RibD; PFAM: RibD C-terminal
FT                   domain; Cytidine and deoxycytidylate deaminase zinc-binding
FT                   region; TIGRFAM: riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33130"
FT                   /db_xref="GOA:E4TZW5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZW5"
FT                   /protein_id="ADR33130.1"
FT                   /translation="MNTTAAIHAMTLALNAAWEYQLLTFPNPAVGAVCLSDNGTVVSVG
FT                   THKRAGGPHAEVYALRDAYTLLSGDTTIAGCDDSHRIHDYLRTRHNGIFHTVSMAVTLE
FT                   PCSHSGKTPSCALLIRDLGIKRVYISVKDPNPAAAGGASLLSDAGAECVFGIMEEEGEK
FT                   LLEPFIRWQKSPFVFFKWAQRLDGTIDNGTISSQSSREHMHALRDRCDLIVIGGNTVRH
FT                   DRPTLDARLVDGKAPDVLIYSQMGEFDQSIPLFSVPDRKVYVESSLERLKEYSLVMIEG
FT                   GTSMFQASQNTCDWYLCYLAPKLGGGLQNMGPIQEDFEVLHAKITDNILLWMKKK"
     MNTTAAIHAM TLALNAAWEY QLLTFPNPAV GAVCLSDNGT VVSVGTHKRA GGPHAEVYAL        60
     RDAYTLLSGD TTIAGCDDSH RIHDYLRTRH NGIFHTVSMA VTLEPCSHSG KTPSCALLIR       120
     DLGIKRVYIS VKDPNPAAAG GASLLSDAGA ECVFGIMEEE GEKLLEPFIR WQKSPFVFFK       180
     WAQRLDGTID NGTISSQSSR EHMHALRDRC DLIVIGGNTV RHDRPTLDAR LVDGKAPDVL       240
     IYSQMGEFDQ SIPLFSVPDR KVYVESSLER LKEYSLVMIE GGTSMFQASQ NTCDWYLCYL       300
     APKLGGGLQN MGPIQEDFEV LHAKITDNIL LWMKKK                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page