(data stored in ACNUC7421 zone)

EMBL: CP002355.PE464

CP002355.PE464       Location/Qualifiers
FT   CDS             451367..452629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0465"
FT                   /product="Exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="COGs: COG1570 Exonuclease VII large subunit;
FT                   InterPro IPR003753: IPR004365: IPR020579; KEGG:
FT                   tdn:Suden_0681 exodeoxyribonuclease VII large subunit;
FT                   PFAM: Exonuclease VII, large subunit-like; nucleic acid
FT                   binding OB-fold tRNA/helicase-type; SPTR:
FT                   Exodeoxyribonuclease 7 large subunit; TIGRFAM:
FT                   exodeoxyribonuclease VII, large subunit; PFAM: Exonuclease
FT                   VII, large subunit; OB-fold nucleic acid binding domain;
FT                   TIGRFAM: exodeoxyribonuclease VII, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33132"
FT                   /db_xref="GOA:E4TZW7"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZW7"
FT                   /protein_id="ADR33132.1"
FT                   /translation="MASTLSVSSLNEQIKTLLETSFEFVSVEGELSRVTKHGSGHIYFT
FT                   LKDNESAIKCVMFKGNASRLKFSLEEGAHVILHGALSLYKPRGEYQINAFSAEPYGAGA
FT                   LAVAFEQLKQKLEAKGYFDPTRKKPFPKFPQTVVLVTSATGAALQDMQRVATQRWPLVK
FT                   LIVLDVLVQGPSASGQIADALRTADTLHADAVVVGRGGGSIEDLWAFNEEIVADALYAM
FT                   KTPTISAVGHEIDWVISDYVADMRAPTPSAAMQMLLPDQNELSQSIDEIRYGAYGMITQ
FT                   RLERKREQLLSMQEAFKRHGVEHRLEVQQELIKELRERLNRQMTQRLEQSRREIIPLME
FT                   RLSQNIESILRQKQFMITQLSEGFNANHPKNKNKSGFAQIAREGKVIDLDALSVGDRFE
FT                   AMNDKRVVRAEVVEIVSINVD"
     MASTLSVSSL NEQIKTLLET SFEFVSVEGE LSRVTKHGSG HIYFTLKDNE SAIKCVMFKG        60
     NASRLKFSLE EGAHVILHGA LSLYKPRGEY QINAFSAEPY GAGALAVAFE QLKQKLEAKG       120
     YFDPTRKKPF PKFPQTVVLV TSATGAALQD MQRVATQRWP LVKLIVLDVL VQGPSASGQI       180
     ADALRTADTL HADAVVVGRG GGSIEDLWAF NEEIVADALY AMKTPTISAV GHEIDWVISD       240
     YVADMRAPTP SAAMQMLLPD QNELSQSIDE IRYGAYGMIT QRLERKREQL LSMQEAFKRH       300
     GVEHRLEVQQ ELIKELRERL NRQMTQRLEQ SRREIIPLME RLSQNIESIL RQKQFMITQL       360
     SEGFNANHPK NKNKSGFAQI AREGKVIDLD ALSVGDRFEA MNDKRVVRAE VVEIVSINVD       420
//

If you have problems or comments...

PBIL Back to PBIL home page