(data stored in ACNUC7421 zone)

EMBL: CP002355.PE465

CP002355.PE465       Location/Qualifiers
FT   CDS             452697..452990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0466"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="COGs: COG1669 nucleotidyltransferase; InterPro
FT                   IPR002934; KEGG: ant:Arnit_1006 DNA polymerase beta
FT                   domain-containing protein region; PFAM: DNA polymerase beta
FT                   domain protein region; SPTR: DNA polymerase beta domain
FT                   protein region; PFAM: Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33133"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZW8"
FT                   /protein_id="ADR33133.1"
FT                   /translation="MTKNEILEILKTLKPRYEQDGLILVGLFGSFSRGEEKSDSDVDIV
FT                   YEIEKGKTFSMFKYLKYLADLEKYLNHKVDLVRAETIKSDLKPYIYKDMIYV"
     MTKNEILEIL KTLKPRYEQD GLILVGLFGS FSRGEEKSDS DVDIVYEIEK GKTFSMFKYL        60
     KYLADLEKYL NHKVDLVRAE TIKSDLKPYI YKDMIYV                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page