(data stored in ACNUC7421 zone)

EMBL: CP002355.PE467

CP002355.PE467       Location/Qualifiers
FT   CDS             complement(453398..454270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0468"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="COGs: COG0616 Periplasmic serine protease (ClpP
FT                   class); InterPro IPR004635: IPR002142; KEGG: tdn:Suden_0685
FT                   peptidase S49, SppA; PFAM: peptidase S49; SPTR: Peptidase
FT                   S49, SppA; TIGRFAM: signal peptide peptidase SppA, 36K
FT                   type; PFAM: Peptidase family S49; TIGRFAM: signal peptide
FT                   peptidase SppA, 36K type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33135"
FT                   /db_xref="GOA:E4TZX0"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX0"
FT                   /protein_id="ADR33135.1"
FT                   /translation="MIEFVKKIGSCLARGLKFIQEHFKATVLVLIVLWLIIPSSENGIT
FT                   PHNLQKIALSGPILDATPIVAQIDEARENDGIKGVLFSIDSPGGAVAPSVEIAYAIKRL
FT                   SETKPTVVYAAGIMASGGYYSGIWGNEIIANPGSMIGSIGVIMEGADISGLMEKVGVKT
FT                   QVVHAGTYKQVGTFDREWSAAERAELNKVIDGTYSMFVVDVARARKLDPLRSGEYADAH
FT                   IFTALQAKKAGLVDSIGVEYDAKKRVEELSKVKDPTWNKEDPMDRFFKRFAAEGATLAH
FT                   LYFPPITLK"
     MIEFVKKIGS CLARGLKFIQ EHFKATVLVL IVLWLIIPSS ENGITPHNLQ KIALSGPILD        60
     ATPIVAQIDE ARENDGIKGV LFSIDSPGGA VAPSVEIAYA IKRLSETKPT VVYAAGIMAS       120
     GGYYSGIWGN EIIANPGSMI GSIGVIMEGA DISGLMEKVG VKTQVVHAGT YKQVGTFDRE       180
     WSAAERAELN KVIDGTYSMF VVDVARARKL DPLRSGEYAD AHIFTALQAK KAGLVDSIGV       240
     EYDAKKRVEE LSKVKDPTWN KEDPMDRFFK RFAAEGATLA HLYFPPITLK                  290
//

If you have problems or comments...

PBIL Back to PBIL home page