(data stored in ACNUC7421 zone)

EMBL: CP002355.PE469

CP002355.PE469       Location/Qualifiers
FT   CDS             455678..456037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0470"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterPro IPR001789; KEGG: tdn:Suden_1034 response regulator
FT                   receiver domain-containing protein; PFAM: response
FT                   regulator receiver; SMART: response regulator receiver;
FT                   SPTR: Response regulator receiver domain protein; PFAM:
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33137"
FT                   /db_xref="GOA:E4TZX2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX2"
FT                   /protein_id="ADR33137.1"
FT                   /translation="MKILVVDDSKLARLFLIKTLKELEPTAAILEAENGLIAVELFKAE
FT                   KPSAVFLDLTMPVMDGYEALKEIIKIDPNAQVVIVSADIQAQAQSTVLESGAKMMIPKP
FT                   INSEKMLSILQQLSI"
     MKILVVDDSK LARLFLIKTL KELEPTAAIL EAENGLIAVE LFKAEKPSAV FLDLTMPVMD        60
     GYEALKEIIK IDPNAQVVIV SADIQAQAQS TVLESGAKMM IPKPINSEKM LSILQQLSI        119
//

If you have problems or comments...

PBIL Back to PBIL home page