(data stored in ACNUC7421 zone)

EMBL: CP002355.PE47

CP002355.PE47        Location/Qualifiers
FT   CDS             complement(45640..46680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0047"
FT                   /product="RecA protein"
FT                   /note="COGs: COG0468 RecA/RadA recombinase;
FT                   InterProIPR020584: IPR013765: IPR001553: IPR020588: IPR
FT                   020587: IPR003593; KEGG: tdn:Suden_2002 recombinase A;
FT                   PFAM: RecA domain protein; SMART: AAA ATPase; SPTR: Protein
FT                   recA; TIGRFAM: recA protein; PFAM: recA bacterial DNA
FT                   recombination protein; TIGRFAM: protein RecA"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32715"
FT                   /db_xref="GOA:E4TW99"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW99"
FT                   /protein_id="ADR32715.1"
FT                   /translation="MMDPQKLKSLELAMKQIDKTFGKGTLMRLGDKEIEPINSISTGSI
FT                   GLDLALGIGGVPEGRVIEIYGPESSGKTTLSLQITAECQKNGGVCAFIDAEHALDIGYA
FT                   KNLGVDVENLLVSQPDYGEQALDIVETIVRSGAVDLIVIDSVAALTPKVEIEGEMNDQQ
FT                   VGVQARLMSKALRKLTGIMHKMNCTIIFINQIRMKIGTMGYGSPETTTGGNALKFYASV
FT                   RIDVRKIATLKQGESQIGNRVKAKVIKNKVAPPFRQAEFDIMFGEGISKEGELVDYGVK
FT                   LDIIDKSGAWFSFEDVKLGQGRENVKQKFKDEPELARKVEEKIKSAMGVSGIIAMDESD
FT                   ISEVDE"
     MMDPQKLKSL ELAMKQIDKT FGKGTLMRLG DKEIEPINSI STGSIGLDLA LGIGGVPEGR        60
     VIEIYGPESS GKTTLSLQIT AECQKNGGVC AFIDAEHALD IGYAKNLGVD VENLLVSQPD       120
     YGEQALDIVE TIVRSGAVDL IVIDSVAALT PKVEIEGEMN DQQVGVQARL MSKALRKLTG       180
     IMHKMNCTII FINQIRMKIG TMGYGSPETT TGGNALKFYA SVRIDVRKIA TLKQGESQIG       240
     NRVKAKVIKN KVAPPFRQAE FDIMFGEGIS KEGELVDYGV KLDIIDKSGA WFSFEDVKLG       300
     QGRENVKQKF KDEPELARKV EEKIKSAMGV SGIIAMDESD ISEVDE                      346
//

If you have problems or comments...

PBIL Back to PBIL home page