(data stored in ACNUC7421 zone)

EMBL: CP002355.PE470

CP002355.PE470       Location/Qualifiers
FT   CDS             456048..456665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0471"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="COGs: COG1776 Chemotaxis protein CheC inhibitor of
FT                   MCP methylation; InterPro IPR007597; KEGG: tdn:Suden_1035
FT                   CheC, inhibitor of MCP methylation; PFAM: CheC domain
FT                   protein; SPTR: CheC, inhibitor of MCP methylation; PFAM:
FT                   CheC-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33138"
FT                   /db_xref="GOA:E4TZX3"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX3"
FT                   /protein_id="ADR33138.1"
FT                   /translation="MQQNGFTDDHLDMLRELMNIAMGNATASIADLLEAFGKMHIPQIL
FT                   ISDMEGLASYIQQTISDDQRNYVTKQLFGGMFSGEFLFVISEESALHLGHHLYDVDNPS
FT                   DGDILDAVIELTNILSATIISRLTEELNTKVQFFVPSTELIDGNALISQEDIMNYHRII
FT                   IISTQMEFEHQNINGHIFILTKDGMIESLKALIDRKLEELYA"
     MQQNGFTDDH LDMLRELMNI AMGNATASIA DLLEAFGKMH IPQILISDME GLASYIQQTI        60
     SDDQRNYVTK QLFGGMFSGE FLFVISEESA LHLGHHLYDV DNPSDGDILD AVIELTNILS       120
     ATIISRLTEE LNTKVQFFVP STELIDGNAL ISQEDIMNYH RIIIISTQME FEHQNINGHI       180
     FILTKDGMIE SLKALIDRKL EELYA                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page