(data stored in ACNUC7421 zone)

EMBL: CP002355.PE474

CP002355.PE474       Location/Qualifiers
FT   CDS             459014..460282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0475"
FT                   /product="flagellar biosynthetic protein FlhF"
FT                   /note="COGs: COG1419 Flagellar GTP-binding protein;
FT                   InterPro IPR020006: IPR000897: IPR003593; KEGG:
FT                   tdn:Suden_0703 flagellar biosynthesis regulator FlhF; PFAM:
FT                   GTP-binding signal recognition particle SRP54 G- domain;
FT                   SMART: AAA ATPase; SPTR: GTP-binding signal recognition
FT                   particle SRP54, G-domain; TIGRFAM: flagellar biosynthetic
FT                   protein FlhF; PFAM: SRP54-type protein, GTPase domain;
FT                   TIGRFAM: flagellar biosynthetic protein FlhF"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33142"
FT                   /db_xref="GOA:E4TZX7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX7"
FT                   /protein_id="ADR33142.1"
FT                   /translation="MKILTFSGATPAEALKKAQLEVGEEAMLIETREVQKKSLGKSALY
FT                   EIVVGVEENAAPAPKSKAPSDEPFMKQRPLAQKSSDVLYNISAAAKQISKIAEVTEEER
FT                   PSRQTPVRESEDLKRIKEEIEKLGDKVKLIQNMFWSEKSPKTTAAIPPEFAEIYRLAQQ
FT                   SGMDQEHLDEIMHLTLEHMPSKMRESSETVKRYFQVLMRKMIPVRLESAPRPGSKKVIM
FT                   LVGPTGVGKTTSIAKLAARFSYLLEKKYKVGLVVLDTYRIGAVEQLMQYARMMKLGIET
FT                   VVDPPEFSSALNALRYSDYILIDTMGSSPYDKGKIEKIYECLRDNNTDYTVDVVLVMPS
FT                   SIKYDDLKATYENFAPLGIDTMMFTKLDETRGFGNIFSLVYETKVPISYFSVGQEVPED
FT                   LVVATSDFLVDCLMNGFNRGESA"
     MKILTFSGAT PAEALKKAQL EVGEEAMLIE TREVQKKSLG KSALYEIVVG VEENAAPAPK        60
     SKAPSDEPFM KQRPLAQKSS DVLYNISAAA KQISKIAEVT EEERPSRQTP VRESEDLKRI       120
     KEEIEKLGDK VKLIQNMFWS EKSPKTTAAI PPEFAEIYRL AQQSGMDQEH LDEIMHLTLE       180
     HMPSKMRESS ETVKRYFQVL MRKMIPVRLE SAPRPGSKKV IMLVGPTGVG KTTSIAKLAA       240
     RFSYLLEKKY KVGLVVLDTY RIGAVEQLMQ YARMMKLGIE TVVDPPEFSS ALNALRYSDY       300
     ILIDTMGSSP YDKGKIEKIY ECLRDNNTDY TVDVVLVMPS SIKYDDLKAT YENFAPLGID       360
     TMMFTKLDET RGFGNIFSLV YETKVPISYF SVGQEVPEDL VVATSDFLVD CLMNGFNRGE       420
     SA                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page