(data stored in ACNUC7421 zone)

EMBL: CP002355.PE475

CP002355.PE475       Location/Qualifiers
FT   CDS             460279..461151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0476"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="COGs: COG0455 ATPase involved in chromosome
FT                   partitioning; KEGG: tdn:Suden_0704 cobyrinic acid
FT                   a,c-diamide synthase; SPTR: Cobyrinic Acid a,c-diamide
FT                   synthase; PFAM: CobQ/CobB/MinD/ParA nucleotide binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33143"
FT                   /db_xref="GOA:E4TZX8"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX8"
FT                   /protein_id="ADR33143.1"
FT                   /translation="MNHQASKLEALVNQNRNATAKKTRFIAITSGKGGVGKSTISSNMA
FT                   FVMAKYGLKVGIFDADIGLANLDVMFNVKIKKNILHVLKGEATVEEILVPIEPNLVLIP
FT                   GESGEEIFKYASGGLFERFMDQANVLDDLDVMIIDTGAGIGEHIQLFLRACDDVIVVTV
FT                   PDPAAITDAYATIKITSKLRDEINVIMNQVRSMKEAEALFEKINKVAQANIGGALKLSY
FT                   LGQISNDPKISTSVKKRALFSRDFPTATPTNEIEVIVKRIAKKLERNVLVDPKESGLGG
FT                   LFKRLMEHF"
     MNHQASKLEA LVNQNRNATA KKTRFIAITS GKGGVGKSTI SSNMAFVMAK YGLKVGIFDA        60
     DIGLANLDVM FNVKIKKNIL HVLKGEATVE EILVPIEPNL VLIPGESGEE IFKYASGGLF       120
     ERFMDQANVL DDLDVMIIDT GAGIGEHIQL FLRACDDVIV VTVPDPAAIT DAYATIKITS       180
     KLRDEINVIM NQVRSMKEAE ALFEKINKVA QANIGGALKL SYLGQISNDP KISTSVKKRA       240
     LFSRDFPTAT PTNEIEVIVK RIAKKLERNV LVDPKESGLG GLFKRLMEHF                  290
//

If you have problems or comments...

PBIL Back to PBIL home page