(data stored in ACNUC7421 zone)

EMBL: CP002355.PE476

CP002355.PE476       Location/Qualifiers
FT   CDS             461223..461546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0477"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0705 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33144"
FT                   /db_xref="GOA:E4TZX9"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX9"
FT                   /protein_id="ADR33144.1"
FT                   /translation="MRGSNFVYFLTIQGFFVGIVFGILQSDSAENFLGWVILISLFFYL
FT                   FAHLCVGFFFQSLGVKAHSFPKKAHEHNLDFFVREINKREQFIDAFYTHKSELLDDQGR
FT                   GKG"
     MRGSNFVYFL TIQGFFVGIV FGILQSDSAE NFLGWVILIS LFFYLFAHLC VGFFFQSLGV        60
     KAHSFPKKAH EHNLDFFVRE INKREQFIDA FYTHKSELLD DQGRGKG                     107
//

If you have problems or comments...

PBIL Back to PBIL home page