(data stored in ACNUC7421 zone)

EMBL: CP002355.PE478

CP002355.PE478       Location/Qualifiers
FT   CDS             462235..463329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0479"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="COGs: COG1868 Flagellar motor switch protein;
FT                   InterPro IPR001689: IPR001543; KEGG: tdn:Suden_0707
FT                   flagellar motor switch protein FliM; PFAM: flagellar motor
FT                   switch protein FliM; surface presentation of antigens
FT                   (SPOA) protein; SPTR: Flagellar motor switch protein FliM;
FT                   TIGRFAM: flagellar motor switch protein FliM; PFAM: Surface
FT                   presentation of antigens (SPOA); Flagellar motor switch
FT                   protein FliM; TIGRFAM: flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33146"
FT                   /db_xref="GOA:E4TZY1"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY1"
FT                   /protein_id="ADR33146.1"
FT                   /translation="MADILSQEEIDALLDVVDDEGDGLLETTEESLYPQRQITLYDFKR
FT                   PNRVSKEQLRAFRGIHDKMARSIASQISAIMRSIVEIQLHSVDQMTYGEFLMSLPNPTS
FT                   FNVFSMKPLEGNGVLEINPSIAFPMLDRILGGKGEPFEANREFSDIELSLFETILRVMM
FT                   GTLREAWGPVTDLYPQVESKESSPNVVQIVAQNEIVVMVVMEIIIGHSSGMMNICYPVI
FT                   ALEPVLPKLASRDLMLNETSSKKSRNQELQVLLGGAHVNVEVNLGEAELSLHELLELGE
FT                   GDIIRLNIPADDVVNVSVDGKDRFVGQMGLRRFRKSIQITSLIDTEKDAVKRALKEFEM
FT                   KRKARISGVKEMIRGPIEEEDEDE"
     MADILSQEEI DALLDVVDDE GDGLLETTEE SLYPQRQITL YDFKRPNRVS KEQLRAFRGI        60
     HDKMARSIAS QISAIMRSIV EIQLHSVDQM TYGEFLMSLP NPTSFNVFSM KPLEGNGVLE       120
     INPSIAFPML DRILGGKGEP FEANREFSDI ELSLFETILR VMMGTLREAW GPVTDLYPQV       180
     ESKESSPNVV QIVAQNEIVV MVVMEIIIGH SSGMMNICYP VIALEPVLPK LASRDLMLNE       240
     TSSKKSRNQE LQVLLGGAHV NVEVNLGEAE LSLHELLELG EGDIIRLNIP ADDVVNVSVD       300
     GKDRFVGQMG LRRFRKSIQI TSLIDTEKDA VKRALKEFEM KRKARISGVK EMIRGPIEEE       360
     DEDE                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page