(data stored in ACNUC7421 zone)

EMBL: CP002355.PE479

CP002355.PE479       Location/Qualifiers
FT   CDS             463322..464188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0480"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="COGs: COG1886 Flagellar motor switch/type III
FT                   secretory pathway protein; InterPro IPR012826: IPR001543:
FT                   IPR001172; KEGG: tdn:Suden_0708 flagellar motor switch
FT                   protein FliY; PFAM: surface presentation of antigens (SPOA)
FT                   protein; SPTR: Flagellar motor switch FliN; TIGRFAM:
FT                   flagellar motor switch protein FliN; PFAM: Surface
FT                   presentation of antigens (SPOA); TIGRFAM: flagellar motor
FT                   switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33147"
FT                   /db_xref="GOA:E4TZY2"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY2"
FT                   /protein_id="ADR33147.1"
FT                   /translation="MSDFPGVFATEAVATIEGLTGQTPTITLKEAEEISIISNVIPPIA
FT                   QIHVSFSGAAAGRGIVMMPPQLATALGDMMLGGDGEAQDTMSDEDMDAAKEIVSNIVGA
FT                   MSTTLASQKELPKFTIKPERAEFIPESGEVNLDGYAKMFVFTFALGHINSLMMLAIDST
FT                   INEALTGEKAAPAPASNSSNIFDAPSSSVPAVKLDEGEMKNIGLIMGVKLPVRVRIGKK
FT                   KMLLKDVLSMDIGSVIELNQLANDPLDILVDDHVIAQGEVVIVDGNFGVQITSIGTKRD
FT                   RLNKLKG"
     MSDFPGVFAT EAVATIEGLT GQTPTITLKE AEEISIISNV IPPIAQIHVS FSGAAAGRGI        60
     VMMPPQLATA LGDMMLGGDG EAQDTMSDED MDAAKEIVSN IVGAMSTTLA SQKELPKFTI       120
     KPERAEFIPE SGEVNLDGYA KMFVFTFALG HINSLMMLAI DSTINEALTG EKAAPAPASN       180
     SSNIFDAPSS SVPAVKLDEG EMKNIGLIMG VKLPVRVRIG KKKMLLKDVL SMDIGSVIEL       240
     NQLANDPLDI LVDDHVIAQG EVVIVDGNFG VQITSIGTKR DRLNKLKG                    288
//

If you have problems or comments...

PBIL Back to PBIL home page