(data stored in ACNUC7421 zone)

EMBL: CP002355.PE48

CP002355.PE48        Location/Qualifiers
FT   CDS             46854..47717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0048"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2107 periplasmic solute-binding protein;
FT                   KEGG: tdn:Suden_2004 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Putative periplasminc
FT                   binding protein (DUF178)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32716"
FT                   /db_xref="GOA:E4TWA0"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA0"
FT                   /protein_id="ADR32716.1"
FT                   /translation="MKKMVIAHSPDADDIFMYYAIKFGWVGKENTVFENIALDIETLNT
FT                   EALKGTYDITAISFGLYPHIRSDYALLRTAVSFGQGYGPKLIRKKETVLKKRFKVALSG
FT                   KYTTNALLFRIVYPDAKIIYMNFLEIEQAVLDGVVDAGVLIHESILGYDESLEVERELW
FT                   DVWCELSGGDLPLPLGGMAIRRSLPLTSAIEYESVLTKAVQIARDHKETLSKMLMERNL
FT                   VRIDAPTLEKYLELYANDESITLNETQYKAIELLFDLGYKHGFFDAKIDPRDFMLPLEY
FT                   NELRYS"
     MKKMVIAHSP DADDIFMYYA IKFGWVGKEN TVFENIALDI ETLNTEALKG TYDITAISFG        60
     LYPHIRSDYA LLRTAVSFGQ GYGPKLIRKK ETVLKKRFKV ALSGKYTTNA LLFRIVYPDA       120
     KIIYMNFLEI EQAVLDGVVD AGVLIHESIL GYDESLEVER ELWDVWCELS GGDLPLPLGG       180
     MAIRRSLPLT SAIEYESVLT KAVQIARDHK ETLSKMLMER NLVRIDAPTL EKYLELYAND       240
     ESITLNETQY KAIELLFDLG YKHGFFDAKI DPRDFMLPLE YNELRYS                     287
//

If you have problems or comments...

PBIL Back to PBIL home page