(data stored in ACNUC7421 zone)

EMBL: CP002355.PE480

CP002355.PE480       Location/Qualifiers
FT   CDS             464191..464979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0481"
FT                   /product="Conserved hypothetical protein CHP00730"
FT                   /note="COGs: COG1611 Rossmann fold nucleotide-binding
FT                   protein; InterPro IPR005269; KEGG: tdn:Suden_0709
FT                   hypothetical protein; PFAM: Conserved hypothetical protein
FT                   CHP00730; SPTR: Lysine decarboxylase family protein; PFAM:
FT                   Possible lysine decarboxylase; TIGRFAM: conserved
FT                   hypothetical protein, DprA/Smf-related, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33148"
FT                   /db_xref="GOA:E4TZY3"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY3"
FT                   /protein_id="ADR33148.1"
FT                   /translation="MARRHGKTKEYESSRYVKDIKSADVWSVFKIIADFVQGFDELGDL
FT                   GPSVTIFGSARLDENHPYYTQAMTLANMLGEKGYNVITGGGPGIMEAANRGAYEVETVE
FT                   SIGLNIELATEQQPNPYITKGQSFDYFFSRKVMLVKYSMAYVIFPGGFGTLDEMFEALT
FT                   LIQTRKVWGVRLFVVGTEFYAPLLQFIEDKMLAEGMIDDKDVQLINLTDDLDFVVREIE
FT                   KSLISQIHTMEKEGLTDTKYYKALTSHVDETHSYAGQGSS"
     MARRHGKTKE YESSRYVKDI KSADVWSVFK IIADFVQGFD ELGDLGPSVT IFGSARLDEN        60
     HPYYTQAMTL ANMLGEKGYN VITGGGPGIM EAANRGAYEV ETVESIGLNI ELATEQQPNP       120
     YITKGQSFDY FFSRKVMLVK YSMAYVIFPG GFGTLDEMFE ALTLIQTRKV WGVRLFVVGT       180
     EFYAPLLQFI EDKMLAEGMI DDKDVQLINL TDDLDFVVRE IEKSLISQIH TMEKEGLTDT       240
     KYYKALTSHV DETHSYAGQG SS                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page