(data stored in ACNUC7421 zone)

EMBL: CP002355.PE481

CP002355.PE481       Location/Qualifiers
FT   CDS             464979..465998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0482"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="COGs: COG0482
FT                   tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
FT                   contains the PP-loop ATPase domain; InterPro IPR004506;
FT                   KEGG: tdn:Suden_0710 tRNA-specific 2-thiouridylase MnmA;
FT                   SPTR: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   PFAM: tRNA methyl transferase; TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33149"
FT                   /db_xref="GOA:E4TZY4"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY4"
FT                   /protein_id="ADR33149.1"
FT                   /translation="MGKKVLIGMSGGVDSTVSTLLLKEQGYDVEGVYMKLHSKPGYHEI
FT                   HQARAQRAADFAGVKLHILDLQEEFNAKVFTPFIETYKEGKTPNPCALCNRNIKFGAMV
FT                   AYADSIGADYVATGHYIRHDGQYLLQAHDDTKDQSYFLFYIDPALVPRLLFPLGERHKS
FT                   DIKAYAAGIEGLESFASQSESSEICFVETTYMDVLKPYVPVDQEGEVLNLEGKVVGKHK
FT                   GYMHYTIGKRKGFSVHGAHDPHFVVEIKPEINQIVVGTREDLECHRVELERVNMFDSRT
FT                   EFECDVKLRYRTTAVRCSVKIDGDHATVELHEPVLGVASGQAGVFYDGEKLLGGGWIV"
     MGKKVLIGMS GGVDSTVSTL LLKEQGYDVE GVYMKLHSKP GYHEIHQARA QRAADFAGVK        60
     LHILDLQEEF NAKVFTPFIE TYKEGKTPNP CALCNRNIKF GAMVAYADSI GADYVATGHY       120
     IRHDGQYLLQ AHDDTKDQSY FLFYIDPALV PRLLFPLGER HKSDIKAYAA GIEGLESFAS       180
     QSESSEICFV ETTYMDVLKP YVPVDQEGEV LNLEGKVVGK HKGYMHYTIG KRKGFSVHGA       240
     HDPHFVVEIK PEINQIVVGT REDLECHRVE LERVNMFDSR TEFECDVKLR YRTTAVRCSV       300
     KIDGDHATVE LHEPVLGVAS GQAGVFYDGE KLLGGGWIV                              339
//

If you have problems or comments...

PBIL Back to PBIL home page