(data stored in ACNUC7421 zone)

EMBL: CP002355.PE482

CP002355.PE482       Location/Qualifiers
FT   CDS             466148..467377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0483"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: pmx:PERMA_1526 general
FT                   substrate transporter; PFAM: major facilitator superfamily
FT                   MFS_1; SPTR: Major facilitator family transporter; PFAM:
FT                   Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33150"
FT                   /db_xref="GOA:E4TZY5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY5"
FT                   /protein_id="ADR33150.1"
FT                   /translation="MTSKKKIVAAGIIGNVIEYYDFALIGFLAVMMGNLFFPSHDPFLS
FT                   LLGSFGAFAAGMIMRPVGALIFGHIGDRVSRRTALMSSLLMMALPTFLIGFLPTYAQIG
FT                   ILAPILLVLLRMIQGLSVGGEYASSIVYLVEQSAPDHQNLYGSFVSVGAKIGMALGSGF
FT                   CGALLWYIGGDAMGEWGWRIPFWASIIIAAAGLYLRRNLTDDYRPSEDKTVPIVAILRH
FT                   HRREFWQFLTIASAIWVFYYTVFIYLPIWLEGSAGLSKAEAGQINTLSIVVGVVFIPLM
FT                   AMVADVIGSLRLMRLTSITLAISVYPLFYWMSIGGFWGALAGTIGLVILLCAFQAPIFA
FT                   STVNALHYHGYRASFTAVILGSAAGIVGGITPALMTSITEYSGNPFAPSYLIAAASLMG
FT                   GWGILRNVRA"
     MTSKKKIVAA GIIGNVIEYY DFALIGFLAV MMGNLFFPSH DPFLSLLGSF GAFAAGMIMR        60
     PVGALIFGHI GDRVSRRTAL MSSLLMMALP TFLIGFLPTY AQIGILAPIL LVLLRMIQGL       120
     SVGGEYASSI VYLVEQSAPD HQNLYGSFVS VGAKIGMALG SGFCGALLWY IGGDAMGEWG       180
     WRIPFWASII IAAAGLYLRR NLTDDYRPSE DKTVPIVAIL RHHRREFWQF LTIASAIWVF       240
     YYTVFIYLPI WLEGSAGLSK AEAGQINTLS IVVGVVFIPL MAMVADVIGS LRLMRLTSIT       300
     LAISVYPLFY WMSIGGFWGA LAGTIGLVIL LCAFQAPIFA STVNALHYHG YRASFTAVIL       360
     GSAAGIVGGI TPALMTSITE YSGNPFAPSY LIAAASLMGG WGILRNVRA                   409
//

If you have problems or comments...

PBIL Back to PBIL home page