(data stored in ACNUC7421 zone)

EMBL: CP002355.PE483

CP002355.PE483       Location/Qualifiers
FT   CDS             complement(467358..468119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0484"
FT                   /product="carbonic anhydrase"
FT                   /note="COGs: COG0288 Carbonic anhydrase; InterPro
FT                   IPR001765; KEGG: cvi:CV_1136 hypothetical protein; PFAM:
FT                   carbonic anhydrase; SPTR: Carbonic anhydrase; PFAM:
FT                   Carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33151"
FT                   /db_xref="GOA:E4TZY6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY6"
FT                   /protein_id="ADR33151.1"
FT                   /translation="MDKRTFLKFFALTSSSLLLANSAEASSAHAAPNTQELQEIAQKMF
FT                   AEVISQNDYYVNHQGSAFFEKLKNGQHPRATVIGCSDSRFQSAALDATAENDLFIIRNI
FT                   GNQFSSNMGSVEYGVRHLNTPLLIIVGHSRCGAIKAALGDYSSEGPHIIKELDSLSLAV
FT                   RKTSMMGTEEAKWLAAVVSNINQQVYYAQKEFKGDVESGKLTIVGVVYDLANDFNNGYG
FT                   RLKIVNINGESNPGKMMDYPLMKSLFKPVHF"
     MDKRTFLKFF ALTSSSLLLA NSAEASSAHA APNTQELQEI AQKMFAEVIS QNDYYVNHQG        60
     SAFFEKLKNG QHPRATVIGC SDSRFQSAAL DATAENDLFI IRNIGNQFSS NMGSVEYGVR       120
     HLNTPLLIIV GHSRCGAIKA ALGDYSSEGP HIIKELDSLS LAVRKTSMMG TEEAKWLAAV       180
     VSNINQQVYY AQKEFKGDVE SGKLTIVGVV YDLANDFNNG YGRLKIVNIN GESNPGKMMD       240
     YPLMKSLFKP VHF                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page