(data stored in ACNUC7421 zone)

EMBL: CP002355.PE484

CP002355.PE484       Location/Qualifiers
FT   CDS             complement(468164..469027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0485"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="COGs: COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein); InterPro IPR011812:
FT                   IPR001264; KEGG: cte:CT2025 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase; PFAM: glycosyl transferase
FT                   family 51; SPTR: Monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; TIGRFAM: monofunctional biosynthetic
FT                   peptidoglycan transglycosylase; PFAM: Transglycosylase;
FT                   TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33152"
FT                   /db_xref="GOA:E4TZY7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY7"
FT                   /protein_id="ADR33152.1"
FT                   /translation="MQKLKTILLLLLLAGAIDIGRYFIYPNIDDLKDIRPIPTAFMEYR
FT                   QNEWADENRDMEITQKWVSMSQISPNVIKAVLIGEDDKFWNHDGFDVTGMEQALERSLK
FT                   KGSVAGGSTISQQLSKNLYLSPSKNPVRKIKEAIITWRIEHALSKRRILEIYLNVAEWG
FT                   DGIFGIEAAARHYYHKSAKNLTGQEAARLAAVLPNPIKYDPTGSQKYVKNRSRIIYKIM
FT                   KRRGIVIPQFKEVMTPPRESESPAVENNQSITDLFDQTAPEETAPQEQIDVPVSNGTEK
FT                   NESITF"
     MQKLKTILLL LLLAGAIDIG RYFIYPNIDD LKDIRPIPTA FMEYRQNEWA DENRDMEITQ        60
     KWVSMSQISP NVIKAVLIGE DDKFWNHDGF DVTGMEQALE RSLKKGSVAG GSTISQQLSK       120
     NLYLSPSKNP VRKIKEAIIT WRIEHALSKR RILEIYLNVA EWGDGIFGIE AAARHYYHKS       180
     AKNLTGQEAA RLAAVLPNPI KYDPTGSQKY VKNRSRIIYK IMKRRGIVIP QFKEVMTPPR       240
     ESESPAVENN QSITDLFDQT APEETAPQEQ IDVPVSNGTE KNESITF                     287
//

If you have problems or comments...

PBIL Back to PBIL home page