(data stored in ACNUC7421 zone)

EMBL: CP002355.PE485

CP002355.PE485       Location/Qualifiers
FT   CDS             complement(469029..469655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0486"
FT                   /product="Uncharacterized protein family UPF0126"
FT                   /note="COGs: COG2860 membrane protein; InterPro IPR005115;
FT                   KEGG: tdn:Suden_1580 hypothetical protein; PFAM:
FT                   Uncharacterised protein family UPF0126; SPTR: Membrane
FT                   protein; manually curated; PFAM: UPF0126 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33153"
FT                   /db_xref="GOA:E4TZY8"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY8"
FT                   /protein_id="ADR33153.1"
FT                   /translation="MSEFNLVVFADILGIIAFALSGFLVGVRSNLDLLGIIISASLTAL
FT                   GGGVVRDVILDRTPFAFNEYYPAITVLTTIAIAFAFRLYHREQIERQWLFVISDTIGLV
FT                   AFSITGALLAIDAGFNFFGVIILSFLTAIGGGVLRDILINQVPAVLVSDFYGSIALIVS
FT                   ILLLVFSAVIGLSTLSVAIVAFIAITLRLAAYIKGWHLPTLNTDH"
     MSEFNLVVFA DILGIIAFAL SGFLVGVRSN LDLLGIIISA SLTALGGGVV RDVILDRTPF        60
     AFNEYYPAIT VLTTIAIAFA FRLYHREQIE RQWLFVISDT IGLVAFSITG ALLAIDAGFN       120
     FFGVIILSFL TAIGGGVLRD ILINQVPAVL VSDFYGSIAL IVSILLLVFS AVIGLSTLSV       180
     AIVAFIAITL RLAAYIKGWH LPTLNTDH                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page