(data stored in ACNUC7421 zone)

EMBL: CP002355.PE488

CP002355.PE488       Location/Qualifiers
FT   CDS             472366..472953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0489"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="InterPro IPR001440: IPR019734: IPR013026; KEGG:
FT                   tdn:Suden_0443 TPR repeat-containing protein; PFAM:
FT                   Tetratricopeptide TPR_1 repeat-containing protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33156"
FT                   /db_xref="GOA:E4TZZ1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ1"
FT                   /protein_id="ADR33156.1"
FT                   /translation="MSIFQILMFAATLFFAYQIFRHVQNLDDAQPHKKESNIVDTAVFS
FT                   ASALVEEADNAYQRGELDRARTALEEASRIESENPEILNKLAFITAKTGDRLKAIELYE
FT                   QSLELDENDDLTHNAIASLYRAENAYERAQDHYLKAIEIDDTYPQTFYNYANLLVDMDE
FT                   VEKARGMYKRALELQSDFPEAREALLSLGAHV"
     MSIFQILMFA ATLFFAYQIF RHVQNLDDAQ PHKKESNIVD TAVFSASALV EEADNAYQRG        60
     ELDRARTALE EASRIESENP EILNKLAFIT AKTGDRLKAI ELYEQSLELD ENDDLTHNAI       120
     ASLYRAENAY ERAQDHYLKA IEIDDTYPQT FYNYANLLVD MDEVEKARGM YKRALELQSD       180
     FPEAREALLS LGAHV                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page