(data stored in ACNUC7421 zone)

EMBL: CP002355.PE489

CP002355.PE489       Location/Qualifiers
FT   CDS             472950..473690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0490"
FT                   /product="protein of unknown function DUF88"
FT                   /note="KEGG: mmh:Mmah_0289 protein of unknown function
FT                   DUF88; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33157"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ2"
FT                   /protein_id="ADR33157.1"
FT                   /translation="MIDDQARLAVLIDADNSQPSIIAGLMDEIAAHGIASVKRIYGDWT
FT                   DTKLKGWKNALLEHGLHPMQQFAYTTGKNATDSAMIIDAMDLLYTKNFDGFCIVSSDSD
FT                   FTRLASRIRESGIKVYGFGEQKTPKAFIGVCDKFIYTENLRRDANHKEPVGTKIKPDNK
FT                   ALLALVRNAVEDTTNEAGWSYLGSIGQNLINKSPEFDPRSYGFKKLLDLIESLGEFEFK
FT                   FSDPLSGSQAVHVRLKRHKRSYEK"
     MIDDQARLAV LIDADNSQPS IIAGLMDEIA AHGIASVKRI YGDWTDTKLK GWKNALLEHG        60
     LHPMQQFAYT TGKNATDSAM IIDAMDLLYT KNFDGFCIVS SDSDFTRLAS RIRESGIKVY       120
     GFGEQKTPKA FIGVCDKFIY TENLRRDANH KEPVGTKIKP DNKALLALVR NAVEDTTNEA       180
     GWSYLGSIGQ NLINKSPEFD PRSYGFKKLL DLIESLGEFE FKFSDPLSGS QAVHVRLKRH       240
     KRSYEK                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page