(data stored in ACNUC7421 zone)

EMBL: CP002355.PE49

CP002355.PE49        Location/Qualifiers
FT   CDS             47719..47988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0049"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="COGs: COG1987 Flagellar biosynthesis pathway
FT                   component FliQ; InterPro IPR006305: IPR002191; KEGG:
FT                   tdn:Suden_2005 flagellar biosynthesis protein FliQ; PFAM:
FT                   export protein FliQ family 3; SPTR: Flagellar biosynthesis
FT                   protein FliQ; TIGRFAM: flagellar biosynthetic protein FliQ;
FT                   PFAM: Bacterial export proteins, family 3; TIGRFAM:
FT                   flagellar biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32717"
FT                   /db_xref="GOA:E4TWA1"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA1"
FT                   /protein_id="ADR32717.1"
FT                   /translation="MVQSELIGLGIETFKIALILSLPALLVGMFLGLAVSIFQATTQIN
FT                   EMTLSFIPKIIGIVVVIILTMPWMMNEMQDFTIRMFNLIPTFMQ"
     MVQSELIGLG IETFKIALIL SLPALLVGMF LGLAVSIFQA TTQINEMTLS FIPKIIGIVV        60
     VIILTMPWMM NEMQDFTIRM FNLIPTFMQ                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page