(data stored in ACNUC7421 zone)

EMBL: CP002355.PE490

CP002355.PE490       Location/Qualifiers
FT   CDS             473687..474409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0491"
FT                   /product="protein of unknown function DUF34"
FT                   /note="COGs: COG0327 conserved hypothetical protein;
FT                   InterPro IPR002678; KEGG: tdn:Suden_0444 hypothetical
FT                   protein; PFAM: protein of unknown function DUF34; SPTR:
FT                   Putative uncharacterized protein; PFAM: NIF3 (NGG1p
FT                   interacting factor 3); TIGRFAM: dinuclear metal center
FT                   protein, YbgI/SA1388 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33158"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ3"
FT                   /protein_id="ADR33158.1"
FT                   /translation="MTVQEIYTYLDGLSPFATQEGWDNSGLLVGDFAQEITHVVLSIDI
FT                   DEELIETIPENALLITHHPVIFGGLKQLQFNQYPAKILMPLIRKNITNIAMHTNFDQTH
FT                   LNDYVATEVLGYPIIAKEGFVAYLGVDEPYDAFAEKIKTALGLPHTRGVKCHDHIRTCA
FT                   LVTGSGASLMRNIEAECFLTGDIKYHDAMEAKALGLSMIDIGHYESERYFGEVLGGYLE
FT                   KLGLSVIISPSKNPFTYL"
     MTVQEIYTYL DGLSPFATQE GWDNSGLLVG DFAQEITHVV LSIDIDEELI ETIPENALLI        60
     THHPVIFGGL KQLQFNQYPA KILMPLIRKN ITNIAMHTNF DQTHLNDYVA TEVLGYPIIA       120
     KEGFVAYLGV DEPYDAFAEK IKTALGLPHT RGVKCHDHIR TCALVTGSGA SLMRNIEAEC       180
     FLTGDIKYHD AMEAKALGLS MIDIGHYESE RYFGEVLGGY LEKLGLSVII SPSKNPFTYL       240
//

If you have problems or comments...

PBIL Back to PBIL home page