(data stored in ACNUC7421 zone)

EMBL: CP002355.PE491

CP002355.PE491       Location/Qualifiers
FT   CDS             474449..475171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0492"
FT                   /product="protein of unknown function DUF164"
FT                   /note="COGs: COG1579 Zn-ribbon protein possibly nucleic
FT                   acid-binding; InterPro IPR003743; KEGG: tdn:Suden_0445
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF164; SPTR: Putative uncharacterized protein; PFAM:
FT                   Putative zinc ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33159"
FT                   /db_xref="InterPro:IPR003743"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ4"
FT                   /protein_id="ADR33159.1"
FT                   /translation="MNKHLEQLIELSHVDKEIDAFEPQIEEANLQYDALLATKNSITNE
FT                   INALKQEIKDEQIKKHKNELHLAELSAKLEENSKKSNEVKTEREMKSLQLEEEIAKEQV
FT                   SFANEEIERLEKLIDHKQSKIDELEAKAAEIDGTLAGVKADVDVKLARIDEERKEVFAR
FT                   KEALVGAMNQKGLSFYQKIRRWAKNTTAVAVRNQACMGCYMAISDKVYSDVIKGEEITM
FT                   CPHCGRILFLEPSDAIGA"
     MNKHLEQLIE LSHVDKEIDA FEPQIEEANL QYDALLATKN SITNEINALK QEIKDEQIKK        60
     HKNELHLAEL SAKLEENSKK SNEVKTEREM KSLQLEEEIA KEQVSFANEE IERLEKLIDH       120
     KQSKIDELEA KAAEIDGTLA GVKADVDVKL ARIDEERKEV FARKEALVGA MNQKGLSFYQ       180
     KIRRWAKNTT AVAVRNQACM GCYMAISDKV YSDVIKGEEI TMCPHCGRIL FLEPSDAIGA       240
//

If you have problems or comments...

PBIL Back to PBIL home page