(data stored in ACNUC7421 zone)

EMBL: CP002355.PE492

CP002355.PE492       Location/Qualifiers
FT   CDS             475164..476327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0493"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain-containing protein"
FT                   /note="COGs: COG1519 3-deoxy-D-manno-octulosonic-acid
FT                   transferase; InterPro IPR007507; KEGG: tdn:Suden_0446
FT                   3-deoxy-D-manno-octulosonic-acid transferase; PFAM:
FT                   Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain-containing protein; SPTR:
FT                   3-deoxy-D-manno-octulosonic-acid transferase; PFAM:
FT                   3-Deoxy-D-manno-octulosonic-acid transferase
FT                   (kdotransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33160"
FT                   /db_xref="GOA:E4TZZ5"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ5"
FT                   /protein_id="ADR33160.1"
FT                   /translation="MRNVVFDLIYTLVAAFFYVAALPLLILFSFKKKYRDSIPARFFGI
FT                   KNPPFQPHDIWFHVCSFGEAKAIAPVLEKLKDKKIAISVITHTGYEAASKYAAQVRYLP
FT                   YELWLWFWIERPKTVVVLEAEFWYLLFRLASRRGARVIALNARISDRSFSKYYRMRWFY
FT                   RILLSQCDRVFCQSSEDMVRFIALGARNVEVVGNIKLAQKIESNKHYPKPNGLLIVAAS
FT                   THEGEEEGIIRGFMAYREHNPSAKLLVVPRHPERFAKVGELIAKTAPKMTLSRWSESQM
FT                   ITEDITLIDTMGDLNNLYAISDVVVLGGAYAPIGGHNPLEPATFGCRIISGMEIFHQRE
FT                   LFKYVSHVQFTSVEGIAEALKNAETMPPSQINGSVDLKKVLNYLTEK"
     MRNVVFDLIY TLVAAFFYVA ALPLLILFSF KKKYRDSIPA RFFGIKNPPF QPHDIWFHVC        60
     SFGEAKAIAP VLEKLKDKKI AISVITHTGY EAASKYAAQV RYLPYELWLW FWIERPKTVV       120
     VLEAEFWYLL FRLASRRGAR VIALNARISD RSFSKYYRMR WFYRILLSQC DRVFCQSSED       180
     MVRFIALGAR NVEVVGNIKL AQKIESNKHY PKPNGLLIVA ASTHEGEEEG IIRGFMAYRE       240
     HNPSAKLLVV PRHPERFAKV GELIAKTAPK MTLSRWSESQ MITEDITLID TMGDLNNLYA       300
     ISDVVVLGGA YAPIGGHNPL EPATFGCRII SGMEIFHQRE LFKYVSHVQF TSVEGIAEAL       360
     KNAETMPPSQ INGSVDLKKV LNYLTEK                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page