(data stored in ACNUC7421 zone)

EMBL: CP002355.PE494

CP002355.PE494       Location/Qualifiers
FT   CDS             477403..478749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0495"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /note="COGs: COG0541 Signal recognition particle GTPase;
FT                   InterProIPR004780: IPR013822: IPR000897: IPR004125: IPR
FT                   003593; KEGG: tdn:Suden_0450 signal recognition particle
FT                   protein; PFAM: GTP-binding signal recognition particle
FT                   SRP54 G- domain; GTP-binding signal recognition particle
FT                   SRP54 helical bundle; Signal peptide binding (SRP54) M-
FT                   domain protein; SMART: AAA ATPase; SPTR: Signal recognition
FT                   particle protein; TIGRFAM: signal recognition particle
FT                   protein; PFAM: SRP54-type protein, GTPase domain;
FT                   SRP54-type protein, helical bundle domain; Signal peptide
FT                   binding domain; TIGRFAM: signal recognition particle
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33162"
FT                   /db_xref="GOA:E4TZZ7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ7"
FT                   /protein_id="ADR33162.1"
FT                   /translation="MFDTLTESFTSAIRKIRFHDDEKALTKALGELKKALLKADVNHKV
FT                   VKELIDSVEIQTKQNGVGKDQFLDALRKSLYALLDVKGKSGFVYAPVAPTVILMTGLQG
FT                   SGKTTTTGKLANWLKTRQKKRVLVVAADLQRLAAVEQLRQVCGAIDVELYADDATKNPV
FT                   EVVKAALEHAKKVLVDVVLIDTAGRLAIDDELMGELAEVKAVANPHEIFYVADSLSGQD
FT                   AVRTAATFNEKIGIDGVILTKYDGDSKGGVALGIASQIQVPLRFIGAGEKMEDLEIFLP
FT                   DRIVNRLMGLGDIEGLAERTASVIDEKKAKALTKKIKKGEFNFNDFLEQMESLKKMGSM
FT                   KSIMGMIPGMGGMASALKDFDLENSTQLKQIKALVSSMTVKEREDPELLNNSRKARLAK
FT                   GCGLDIIEVNRILKQFKNASKMAKRFSGKQGMKDLQSMMGQMQGARLPR"
     MFDTLTESFT SAIRKIRFHD DEKALTKALG ELKKALLKAD VNHKVVKELI DSVEIQTKQN        60
     GVGKDQFLDA LRKSLYALLD VKGKSGFVYA PVAPTVILMT GLQGSGKTTT TGKLANWLKT       120
     RQKKRVLVVA ADLQRLAAVE QLRQVCGAID VELYADDATK NPVEVVKAAL EHAKKVLVDV       180
     VLIDTAGRLA IDDELMGELA EVKAVANPHE IFYVADSLSG QDAVRTAATF NEKIGIDGVI       240
     LTKYDGDSKG GVALGIASQI QVPLRFIGAG EKMEDLEIFL PDRIVNRLMG LGDIEGLAER       300
     TASVIDEKKA KALTKKIKKG EFNFNDFLEQ MESLKKMGSM KSIMGMIPGM GGMASALKDF       360
     DLENSTQLKQ IKALVSSMTV KEREDPELLN NSRKARLAKG CGLDIIEVNR ILKQFKNASK       420
     MAKRFSGKQG MKDLQSMMGQ MQGARLPR                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page