(data stored in ACNUC7421 zone)

EMBL: CP002355.PE495

CP002355.PE495       Location/Qualifiers
FT   CDS             478898..479128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0496"
FT                   /product="SSU ribosomal protein S16P"
FT                   /note="COGs: COG0228 Ribosomal protein S16; InterPro
FT                   IPR000307: IPR020592; KEGG: tdn:Suden_0451 30S ribosomal
FT                   protein S16; PFAM: ribosomal protein S16; SPTR: 30S
FT                   ribosomal protein S16; TIGRFAM: ribosomal protein S16;
FT                   PFAM: Ribosomal protein S16; TIGRFAM: ribosomal protein
FT                   S16"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33163"
FT                   /db_xref="GOA:E4TZZ8"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ8"
FT                   /protein_id="ADR33163.1"
FT                   /translation="MATVIRLTRMGRKKQPFYRIAVTDSRKRRDGGWIELIGYYNPMTD
FT                   PITTKVDEERLNYWLSVGAQMSDRVKKITGK"
     MATVIRLTRM GRKKQPFYRI AVTDSRKRRD GGWIELIGYY NPMTDPITTK VDEERLNYWL        60
     SVGAQMSDRV KKITGK                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page