(data stored in ACNUC7421 zone)

EMBL: CP002355.PE496

CP002355.PE496       Location/Qualifiers
FT   CDS             479131..479370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0497"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1837 RNA-binding protein (contains KH
FT                   domain); KEGG: tdn:Suden_0452 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33164"
FT                   /db_xref="GOA:E4TZZ9"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ9"
FT                   /protein_id="ADR33164.1"
FT                   /translation="MIADFVAGFARLIASYPEEIRVESHEGDEVTEIVLYANQADVGKL
FT                   IGKEGKMIGAIKTVISGCKAKDGKSYRINVEPLS"
     MIADFVAGFA RLIASYPEEI RVESHEGDEV TEIVLYANQA DVGKLIGKEG KMIGAIKTVI        60
     SGCKAKDGKS YRINVEPLS                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page