(data stored in ACNUC7421 zone)

EMBL: CP002355.PE497

CP002355.PE497       Location/Qualifiers
FT   CDS             479351..479905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0498"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="COGs: COG0806 RimM protein required for 16S rRNA
FT                   processing; InterPro IPR011961: IPR002676: IPR007903; KEGG:
FT                   tdn:Suden_0453 16S rRNA processing protein RimM; PFAM: RimM
FT                   protein; PRC-barrel domain protein; SPTR: Ribosome
FT                   maturation factor rimM; TIGRFAM: 16S rRNA processing
FT                   protein RimM; PFAM: RimM N-terminal domain; TIGRFAM: 16S
FT                   rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33165"
FT                   /db_xref="GOA:E4U000"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:E4U000"
FT                   /protein_id="ADR33165.1"
FT                   /translation="MSNRFRNSPSHDLLHVATLGRTVGLKGDMKLNLSTDFPEQFIPNA
FT                   TFTLDNGKEVTLSSYNPDRELVHLKGIDTPEAAKALTNAKLFTTFEATRERCNLGEGEF
FT                   FWFDLLGSKVVEGESVLGKVQEIERIGPLDYLLVATDPSLVSKGMAATFLIPYIDRFVL
FT                   GTDATAKVITVEGGLDLLEAS"
     MSNRFRNSPS HDLLHVATLG RTVGLKGDMK LNLSTDFPEQ FIPNATFTLD NGKEVTLSSY        60
     NPDRELVHLK GIDTPEAAKA LTNAKLFTTF EATRERCNLG EGEFFWFDLL GSKVVEGESV       120
     LGKVQEIERI GPLDYLLVAT DPSLVSKGMA ATFLIPYIDR FVLGTDATAK VITVEGGLDL       180
     LEAS                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page