(data stored in ACNUC7421 zone)

EMBL: CP002355.PE499

CP002355.PE499       Location/Qualifiers
FT   CDS             480590..480949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0500"
FT                   /product="LSU ribosomal protein L19P"
FT                   /note="COGs: COG0335 Ribosomal protein L19; InterPro
FT                   IPR001857: IPR018257; KEGG: tdn:Suden_0455 50S ribosomal
FT                   protein L19; PFAM: ribosomal protein L19; SPTR: 50S
FT                   ribosomal protein L19; TIGRFAM: ribosomal protein L19;
FT                   PFAM: Ribosomal protein L19; TIGRFAM: ribosomal protein
FT                   L19, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33167"
FT                   /db_xref="GOA:E4U002"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:E4U002"
FT                   /protein_id="ADR33167.1"
FT                   /translation="MKNKYIASFEQAQIASKNVPEFRAGDTLRLAVTITEGEKSRVQNY
FT                   EGICISIRGEGTGKTITVRKIGANGVGIERVFPIYSDSLEKIEVLRRGRVRRAKLFYLR
FT                   DLAGKAARIKEIRRK"
     MKNKYIASFE QAQIASKNVP EFRAGDTLRL AVTITEGEKS RVQNYEGICI SIRGEGTGKT        60
     ITVRKIGANG VGIERVFPIY SDSLEKIEVL RRGRVRRAKL FYLRDLAGKA ARIKEIRRK        119
//

If you have problems or comments...

PBIL Back to PBIL home page