(data stored in ACNUC7421 zone)

EMBL: CP002355.PE5

CP002355.PE5         Location/Qualifiers
FT   CDS             6616..7005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0005"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /EC_number="1.7.1.13"
FT                   /note="COGs: COG0780 Enzyme related to GTP cyclohydrolase
FT                   I; InterPro IPR016856: IPR020602; KEGG: tdn:Suden_0004
FT                   7-cyano-7-deazaguanine reductase; PFAM: GTP cyclohydrolase
FT                   I/Nitrile oxidoreductase; PRIAM: PreQ(1) synthase; SPTR:
FT                   NADPH-dependent 7-cyano-7-deazaguanine reductase; TIGRFAM:
FT                   7-cyano-7-deazaguanine reductase; PFAM: GTP cyclohydrolase
FT                   I; TIGRFAM: 7-cyano-7-deazaguanine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32673"
FT                   /db_xref="GOA:E4TW57"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW57"
FT                   /protein_id="ADR32673.1"
FT                   /translation="MKYGEQIVENFDVEKDFEIWPNQHERDYVIKVTLPEFTCLCPRSG
FT                   YPDFATIYVEYTPDKWVAELKAIKLYINSFRNRHISHENSANEIYSVFEQKIAPKRLKV
FT                   VADYYPRGNVHTVVEIDSEKMVKEK"
     MKYGEQIVEN FDVEKDFEIW PNQHERDYVI KVTLPEFTCL CPRSGYPDFA TIYVEYTPDK        60
     WVAELKAIKL YINSFRNRHI SHENSANEIY SVFEQKIAPK RLKVVADYYP RGNVHTVVEI       120
     DSEKMVKEK                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page