(data stored in ACNUC7421 zone)

EMBL: CP002355.PE50

CP002355.PE50        Location/Qualifiers
FT   CDS             48100..48888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0050"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /note="COGs: COG0812 UDP-N-acetylmuramate dehydrogenase;
FT                   InterPro IPR003170: IPR011601; KEGG: tdn:Suden_2006
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase
FT                   domain-containing protein; SPTR:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal
FT                   domain; TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32718"
FT                   /db_xref="GOA:E4TWA2"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA2"
FT                   /protein_id="ADR32718.1"
FT                   /translation="MLNTKTIDFSKFSSIRIGPIVEVALIENDVVPEGHMIVGSANNVL
FT                   ISPTPPPLMILSKEYDFIRLEDDGLHIGAATPGGRVVSFCKKNDIAHFEYLSKLPGTLG
FT                   GMLKMNAGLKEYEIFNHLIAIRTMSGWKQKNEIEFGYRKTSIHEVVFEAVFEVHPGYSN
FT                   ERYEMFSQMRSNQPNDPSAGSCFKNPPGDYAGRLIEAVGLKGVRQGSMAFSEVHANFLV
FT                   NTGGGTYSDALTLIHEAQKRIKEQFDIDLQCEIVLIDQKI"
     MLNTKTIDFS KFSSIRIGPI VEVALIENDV VPEGHMIVGS ANNVLISPTP PPLMILSKEY        60
     DFIRLEDDGL HIGAATPGGR VVSFCKKNDI AHFEYLSKLP GTLGGMLKMN AGLKEYEIFN       120
     HLIAIRTMSG WKQKNEIEFG YRKTSIHEVV FEAVFEVHPG YSNERYEMFS QMRSNQPNDP       180
     SAGSCFKNPP GDYAGRLIEA VGLKGVRQGS MAFSEVHANF LVNTGGGTYS DALTLIHEAQ       240
     KRIKEQFDID LQCEIVLIDQ KI                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page