(data stored in ACNUC7421 zone)

EMBL: CP002355.PE500

CP002355.PE500       Location/Qualifiers
FT   CDS             complement(481035..481487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0501"
FT                   /product="SsrA-binding protein"
FT                   /note="COGs: COG0691 tmRNA-binding protein; InterPro
FT                   IPR000037: IPR020081; KEGG: tdn:Suden_0441 SsrA-binding
FT                   protein; PFAM: SmpB protein; SPTR: SsrA-binding protein;
FT                   TIGRFAM: SsrA-binding protein; PFAM: SmpB protein; TIGRFAM:
FT                   SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33168"
FT                   /db_xref="GOA:E4U003"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:E4U003"
FT                   /protein_id="ADR33168.1"
FT                   /translation="MGENIATNKKAFFDYYIEEKFEAGLVLKGSEVKSLRAGRVNLKDG
FT                   FIKIVRGEAFVFGVHIGVLDTTHRFYAHEERGSRKLLLHKKQIDKMFKAVEKEGFTLVP
FT                   LSIYFNDRNIAKMQVAIVKGKKLYDKRDDLKEKSIKRDIERALKGE"
     MGENIATNKK AFFDYYIEEK FEAGLVLKGS EVKSLRAGRV NLKDGFIKIV RGEAFVFGVH        60
     IGVLDTTHRF YAHEERGSRK LLLHKKQIDK MFKAVEKEGF TLVPLSIYFN DRNIAKMQVA       120
     IVKGKKLYDK RDDLKEKSIK RDIERALKGE                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page