(data stored in ACNUC7421 zone)

EMBL: CP002355.PE501

CP002355.PE501       Location/Qualifiers
FT   CDS             complement(481535..481825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_0548 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33169"
FT                   /db_xref="UniProtKB/TrEMBL:E4U004"
FT                   /protein_id="ADR33169.1"
FT                   /translation="MKNEPIYLDQEENELLNEIENGEWVSNPLSPQERQAYQNNAKYTK
FT                   SLQEKRQTTIRFSVSDLAVIKAKSKEMGIGYQNLIQALVHNYAVGKIKLEA"
     MKNEPIYLDQ EENELLNEIE NGEWVSNPLS PQERQAYQNN AKYTKSLQEK RQTTIRFSVS        60
     DLAVIKAKSK EMGIGYQNLI QALVHNYAVG KIKLEA                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page