(data stored in ACNUC7421 zone)

EMBL: CP002355.PE502

CP002355.PE502       Location/Qualifiers
FT   CDS             complement(481815..482102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_0547 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33170"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="UniProtKB/TrEMBL:E4U005"
FT                   /protein_id="ADR33170.1"
FT                   /translation="MSKIIRWNEEKNQLLQLQRNISFEQVLEKIEKDEIIERYIHPNTE
FT                   KYPNQQIFVIEIDEYIWYVPFVETEEEIFLKSIIPSRKLNAAYGGTKNEK"
     MSKIIRWNEE KNQLLQLQRN ISFEQVLEKI EKDEIIERYI HPNTEKYPNQ QIFVIEIDEY        60
     IWYVPFVETE EEIFLKSIIP SRKLNAAYGG TKNEK                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page