(data stored in ACNUC7421 zone)

EMBL: CP002355.PE503

CP002355.PE503       Location/Qualifiers
FT   CDS             complement(482250..483002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0504"
FT                   /product="Curli production assembly/transport component
FT                   CsgG"
FT                   /note="InterPro IPR005534; KEGG: sul:SYO3AOP1_0256
FT                   hypothetical protein; PFAM: Curli production
FT                   assembly/transport component CsgG; SPTR: Putative
FT                   uncharacterized protein; PFAM: Curli production
FT                   assembly/transport component CsgG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33171"
FT                   /db_xref="GOA:E4U006"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:E4U006"
FT                   /protein_id="ADR33171.1"
FT                   /translation="MNKITIGVIILAMCATLATADENTKVQEIAVPVNKCEAPTLSIAI
FT                   NDIECKAQSCQDTGVPSGGFAALAALASGQGNVKGIGTGVKSMLTNAIKESKCFKIVDL
FT                   EQFEKMKKMLAATGQEVKPPKIDLIISGTISSVDVSKEGGAIAGGVIPIVGLFSKNTSK
FT                   ASIGVEFFTMNPSTLEMGDSKSFKADSEKSSWGFGGFGGAAGGGWSVTKNVALDNVIRD
FT                   VVFSATNYITESYAKDKIVERPKLVAAQ"
     MNKITIGVII LAMCATLATA DENTKVQEIA VPVNKCEAPT LSIAINDIEC KAQSCQDTGV        60
     PSGGFAALAA LASGQGNVKG IGTGVKSMLT NAIKESKCFK IVDLEQFEKM KKMLAATGQE       120
     VKPPKIDLII SGTISSVDVS KEGGAIAGGV IPIVGLFSKN TSKASIGVEF FTMNPSTLEM       180
     GDSKSFKADS EKSSWGFGGF GGAAGGGWSV TKNVALDNVI RDVVFSATNY ITESYAKDKI       240
     VERPKLVAAQ                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page