(data stored in ACNUC7421 zone)

EMBL: CP002355.PE504

CP002355.PE504       Location/Qualifiers
FT   CDS             complement(483273..484034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0505"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritolkinase"
FT                   /note="COGs: COG1947
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate
FT                   synthase; InterPro IPR004424: IPR006204; KEGG:
FT                   tdn:Suden_0440 4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; SPTR:
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinases N terminal domain; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33172"
FT                   /db_xref="GOA:E4U007"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E4U007"
FT                   /protein_id="ADR33172.1"
FT                   /translation="MIRYRAYAKVNIFLKITGMRGEYHTLSSRFMRVKDLFDTLWFEEK
FT                   ATPEFEIRGSFDCEVHANTIYKAYKHLLAVTRSDKLSSFFESHAVCVDKKIPSFAGLGG
FT                   GSSDAATFLTMCNEELELGLSLNELAEIASHIGADVPFFVYGYESANVSGIGEVVERFD
FT                   EPLIDFEVVTPDIQISTPSVYRYYREHLYAPISAEEAARLESTPSRDILAFMSPKEAND
FT                   LYPSALACYSELSEKEGWFFSGSGSSFFRIK"
     MIRYRAYAKV NIFLKITGMR GEYHTLSSRF MRVKDLFDTL WFEEKATPEF EIRGSFDCEV        60
     HANTIYKAYK HLLAVTRSDK LSSFFESHAV CVDKKIPSFA GLGGGSSDAA TFLTMCNEEL       120
     ELGLSLNELA EIASHIGADV PFFVYGYESA NVSGIGEVVE RFDEPLIDFE VVTPDIQIST       180
     PSVYRYYREH LYAPISAEEA ARLESTPSRD ILAFMSPKEA NDLYPSALAC YSELSEKEGW       240
     FFSGSGSSFF RIK                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page