(data stored in ACNUC7421 zone)

EMBL: CP002355.PE506

CP002355.PE506       Location/Qualifiers
FT   CDS             complement(484255..485076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0507"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="COGs: COG0130 Pseudouridine synthase; InterPro
FT                   IPR002501; KEGG: sdl:Sdel_1632 pseudouridylate synthase
FT                   TruB domain protein; PFAM: pseudouridylate synthase TruB
FT                   domain protein; SPTR: tRNA pseudouridine synthase B; PFAM:
FT                   TruB family pseudouridylate synthase (N terminal domain);
FT                   TIGRFAM: tRNA pseudouridine 55 synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33174"
FT                   /db_xref="GOA:E4U009"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E4U009"
FT                   /protein_id="ADR33174.1"
FT                   /translation="MNRLFVAYKPSGISSNQLLGRLKRKYGVKKAGYSGTLDPFAKGVL
FT                   IIAFGNHGRLFRFLNKTPKRYRATLWLGAYSPTLDIEKIETIDEIQPVSVEQIEAIFAS
FT                   LVGELTYLPPKYSAKRIEGRRAYELAREGKEVDLRAITSTIYDLTFKHYCHPFVTFEAT
FT                   VSEGSYIRSLGEIIAEHLGCNGALTALERLNEGQFIFENEKELDIKSSLALTKNRYNGT
FT                   LQTMLLGQPLLREDFEIQEEGTYWIDNGDTISILEITPEGVRYILNKVEAC"
     MNRLFVAYKP SGISSNQLLG RLKRKYGVKK AGYSGTLDPF AKGVLIIAFG NHGRLFRFLN        60
     KTPKRYRATL WLGAYSPTLD IEKIETIDEI QPVSVEQIEA IFASLVGELT YLPPKYSAKR       120
     IEGRRAYELA REGKEVDLRA ITSTIYDLTF KHYCHPFVTF EATVSEGSYI RSLGEIIAEH       180
     LGCNGALTAL ERLNEGQFIF ENEKELDIKS SLALTKNRYN GTLQTMLLGQ PLLREDFEIQ       240
     EEGTYWIDNG DTISILEITP EGVRYILNKV EAC                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page