(data stored in ACNUC7421 zone)

EMBL: CP002355.PE508

CP002355.PE508       Location/Qualifiers
FT   CDS             487296..488195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0509"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847: IPR005119; KEGG: tdn:Suden_0436 LysR family
FT                   transcriptional regulator; PFAM: regulatory protein LysR;
FT                   LysR substrate-binding; SPTR: Transcriptional regulator,
FT                   LysR family; PFAM: Bacterial regulatory helix-turn-helix
FT                   protein, lysR family; LysR substrate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33176"
FT                   /db_xref="GOA:E4U011"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4U011"
FT                   /protein_id="ADR33176.1"
FT                   /translation="MLKDFAKLMTFLTVVREKSFSKASAKLGISQPAVTQQIKFIEDYL
FT                   DTRVVERKKNGIKLTKEGEDLYRIATKLEKAIQVSEKEVLKIINKEFTFIVGASYAIGN
FT                   YVLPSYIGQLKDKINNEVHIRVAFSEEIIDQLLDKKIDIALIESPVFKDGLIYREWEED
FT                   ELVIFSNQPIPKQLRKEDMYKFDWICRDENSHTRKLTSEVFEEIGVECSSFSVIGVVAS
FT                   STAIKETLMRSPKDAARPVVSVISRHVISDEVEEGKLFEARIKNYKIKRKFYIVYSKER
FT                   KHDAFIDNVVTYLLGLKL"
     MLKDFAKLMT FLTVVREKSF SKASAKLGIS QPAVTQQIKF IEDYLDTRVV ERKKNGIKLT        60
     KEGEDLYRIA TKLEKAIQVS EKEVLKIINK EFTFIVGASY AIGNYVLPSY IGQLKDKINN       120
     EVHIRVAFSE EIIDQLLDKK IDIALIESPV FKDGLIYREW EEDELVIFSN QPIPKQLRKE       180
     DMYKFDWICR DENSHTRKLT SEVFEEIGVE CSSFSVIGVV ASSTAIKETL MRSPKDAARP       240
     VVSVISRHVI SDEVEEGKLF EARIKNYKIK RKFYIVYSKE RKHDAFIDNV VTYLLGLKL        299
//

If you have problems or comments...

PBIL Back to PBIL home page