(data stored in ACNUC7421 zone)

EMBL: CP002355.PE509

CP002355.PE509       Location/Qualifiers
FT   CDS             complement(488306..488767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0435 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33177"
FT                   /db_xref="UniProtKB/TrEMBL:E4U012"
FT                   /protein_id="ADR33177.1"
FT                   /translation="MLFDIIKSSSFARLMENHIREMLIYLFENDQNFGILCKIEHVTFD
FT                   PPLPKHLNDEFRSMTLFFLAGYTFESARIENDTLIFEAGFGQENIGSFVSVPLLSIVQI
FT                   IVDDTPAFVNLALPQEQHPIVNIEKHEGVQNSMSALLSNPENQKFLKKK"
     MLFDIIKSSS FARLMENHIR EMLIYLFEND QNFGILCKIE HVTFDPPLPK HLNDEFRSMT        60
     LFFLAGYTFE SARIENDTLI FEAGFGQENI GSFVSVPLLS IVQIIVDDTP AFVNLALPQE       120
     QHPIVNIEKH EGVQNSMSAL LSNPENQKFL KKK                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page