(data stored in ACNUC7421 zone)

EMBL: CP002355.PE51

CP002355.PE51        Location/Qualifiers
FT   CDS             48978..49640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0071 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Resolvase, N
FT                   terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32719"
FT                   /db_xref="GOA:E4TWA3"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA3"
FT                   /protein_id="ADR32719.1"
FT                   /translation="MTVSYIRPDKDFDGVYEQLKLINGYADQKGIAINEEMVDQTSQNK
FT                   RLSERHEVVRFFRSLDGDTLIIYDTWTLSSCIEDVVQMFSCLLKNNNTLHFVKPGVIID
FT                   RKSDTMVVLGLIDQLRQILQDDAKKGIGRPRGSKSSSKFDIHLEQIIDLLKKRRSVSEI
FT                   ARVLDVSRSSLKDYIESRELKEVVNGVIGIGNDEDAEATVIGTIRCPIDESQKRENI"
     MTVSYIRPDK DFDGVYEQLK LINGYADQKG IAINEEMVDQ TSQNKRLSER HEVVRFFRSL        60
     DGDTLIIYDT WTLSSCIEDV VQMFSCLLKN NNTLHFVKPG VIIDRKSDTM VVLGLIDQLR       120
     QILQDDAKKG IGRPRGSKSS SKFDIHLEQI IDLLKKRRSV SEIARVLDVS RSSLKDYIES       180
     RELKEVVNGV IGIGNDEDAE ATVIGTIRCP IDESQKRENI                             220
//

If you have problems or comments...

PBIL Back to PBIL home page