(data stored in ACNUC7421 zone)

EMBL: CP002355.PE510

CP002355.PE510       Location/Qualifiers
FT   CDS             complement(488931..489500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0511"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0387 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Aminotransferase
FT                   class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33178"
FT                   /db_xref="GOA:E4U013"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E4U013"
FT                   /protein_id="ADR33178.1"
FT                   /translation="MLLETIRCEHKEAKHLPYHQKRLELACQALGITKRYDLKALITPP
FT                   DEKLYRCRFLYDQQGYSIEFHPYFPKKISSLKLITCDSLEYPLKYADREVLNALFELRA
FT                   ECDDVLIIKNGCLSDTTIANIALQIDGVWLTPDKPLLRGTTRARLIDEGFLTPAPLRPS
FT                   DIAKATKIALMNAMVGFIEVENGIIP"
     MLLETIRCEH KEAKHLPYHQ KRLELACQAL GITKRYDLKA LITPPDEKLY RCRFLYDQQG        60
     YSIEFHPYFP KKISSLKLIT CDSLEYPLKY ADREVLNALF ELRAECDDVL IIKNGCLSDT       120
     TIANIALQID GVWLTPDKPL LRGTTRARLI DEGFLTPAPL RPSDIAKATK IALMNAMVGF       180
     IEVENGIIP                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page